3pkn/2/1:A/2:A

Sequences
>3pkn-a2-m1-cA (length=79) [Search sequence]
PLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESL
RSKVDEAVAVLQAHQAKEA
>3pkn-a2-m2-cA (length=79) [Search sequence]
PLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESL
RSKVDEAVAVLQAHQAKEA
Structure information
PDB ID 3pkn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif of La-related protein 4 (LARP4)
Assembly ID 2
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
PubMed citation 21098120
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P11940 P11940
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3pknA BioLiP:3pknA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3pkn-a2-m1-cA_3pkn-a2-m2-cA.pdb.gz
Full biological assembly
Download: 3pkn-assembly2.cif.gz

[Back to Home]