3plx/1/2:B/4:B

Sequences
>3plx-a1-m2-cB (length=100) [Search sequence]
ISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVI
IMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI
>3plx-a1-m4-cB (length=100) [Search sequence]
ISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVI
IMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI
Structure information
PDB ID 3plx (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of aspartate alpha-decarboxylase from Campylobacter jejuni subsp. jejuni NCTC 11168
Assembly ID 1
Resolution 1.747Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID B B
UniProt accession Q9PIK3 Q9PIK3
Species 192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819) 192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819)
Function annotation BioLiP:3plxB BioLiP:3plxB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3plx-a1-m2-cB_3plx-a1-m4-cB.pdb.gz
Full biological assembly
Download: 3plx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3plx/1/1:B/3:B 3plx/1/1:B/4:B 3plx/1/2:B/3:B

[Back to Home]