3pm7/1/1:B/1:A

Sequences
>3pm7-a1-m1-cB (length=68) [Search sequence]
SYEILEEVAVLSENARGWRKELNLISWNGRPPKFDLREWAPDHEKGKGITLTNEEFAELS
KTIKSLEH
>3pm7-a1-m1-cA (length=71) [Search sequence]
KEEFSYEILEEVAVLSENARGWRKELNLISWNGRPPKFDLREWAPDHEKGKGITLTNEEF
AELSKTIKSLE
Structure information
PDB ID 3pm7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of EF_3132 protein from Enterococcus faecalis at the resolution 2A, Northeast Structural Genomics Consortium Target EfR184
Assembly ID 1
Resolution 2.001Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 69
Sequence identity between the two chains 0.985
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q82ZD2 Q82ZD2
Species 1351 (Enterococcus faecalis) 1351 (Enterococcus faecalis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3pm7-a1-m1-cB_3pm7-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3pm7-assembly1.cif.gz

[Back to Home]