3poj/6/7:B/8:B

Sequences
>3poj-a6-m7-cB (length=114) [Search sequence]
VECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPC
PYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
>3poj-a6-m8-cB (length=114) [Search sequence]
VECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPC
PYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Structure information
PDB ID 3poj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of MASP-1 CUB2 domain bound to Ethylamine
Assembly ID 6
Resolution 1.451Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
PubMed citation 22078562
Chain information
Chain 1 Chain 2
Model ID 7 8
Chain ID B B
UniProt accession Q8CHN8 Q8CHN8
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:3pojB BioLiP:3pojB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3poj-a6-m7-cB_3poj-a6-m8-cB.pdb.gz
Full biological assembly
Download: 3poj-assembly6.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3poi/3/1:A/2:A 3poi/3/1:A/3:A 3poi/3/2:A/3:A 3poi/3/4:B/5:B 3poi/3/4:B/6:B 3poi/3/5:B/6:B 3poi/4/1:A/2:A 3poi/4/1:A/3:A 3poi/4/2:A/3:A 3poi/4/4:B/5:B 3poi/4/4:B/6:B 3poi/4/5:B/6:B 3poi/5/1:A/2:A 3poi/5/1:A/3:A 3poi/5/2:A/3:A 3poi/6/1:B/7:B 3poi/6/1:B/8:B 3poi/6/7:B/8:B 3poj/3/1:A/2:A 3poj/3/1:A/3:A 3poj/3/2:A/3:A 3poj/3/4:B/5:B 3poj/3/4:B/6:B 3poj/3/5:B/6:B 3poj/4/1:A/2:A 3poj/4/1:A/3:A 3poj/4/2:A/3:A 3poj/4/4:B/5:B 3poj/4/4:B/6:B 3poj/4/5:B/6:B 3poj/5/1:A/2:A 3poj/5/1:A/3:A 3poj/5/2:A/3:A 3poj/6/1:B/7:B 3poj/6/1:B/8:B
Other dimers with similar sequences but different poses
  • 3poj/4/3:A/6:B 3poi/3/1:A/4:B 3poi/3/2:A/5:B 3poi/3/3:A/6:B 3poi/4/1:A/4:B 3poi/4/2:A/5:B 3poi/4/3:A/6:B 3poj/3/1:A/4:B 3poj/3/2:A/5:B 3poj/3/3:A/6:B 3poj/4/1:A/4:B 3poj/4/2:A/5:B
  • 3poj/4/1:A/6:B 3poi/3/1:A/5:B 3poi/3/2:A/6:B 3poi/3/3:A/4:B 3poi/4/1:A/5:B 3poi/4/2:A/6:B 3poi/4/3:A/4:B 3poj/3/1:A/6:B 3poj/3/2:A/4:B 3poj/3/3:A/5:B 3poj/4/2:A/4:B 3poj/4/3:A/5:B
  • 3dem/1/1:B/1:A 4aqb/1/1:A/2:A 5ckq/1/1:A/2:A
  • [Back to Home]