3pqh/3/2:B/3:B

Sequences
>3pqh-a3-m2-cB (length=107) [Search sequence]
EKVIISNNKQTYASFDPNGNISVYNTQGMKIDMTPNSIVLTDAGGGKLTLQGGTMTYKGG
TVNLNGLTITPDGRMTDSGGIGLHTHTHPVRGVETGGSTVTSDKPNG
>3pqh-a3-m3-cB (length=107) [Search sequence]
EKVIISNNKQTYASFDPNGNISVYNTQGMKIDMTPNSIVLTDAGGGKLTLQGGTMTYKGG
TVNLNGLTITPDGRMTDSGGIGLHTHTHPVRGVETGGSTVTSDKPNG
Structure information
PDB ID 3pqh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the C-terminal fragment of the bacteriophage phi92 membrane-piercing protein gp138
Assembly ID 3
Resolution 1.295Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 197
Sequence identity between the two chains 1.0
PubMed citation 22325780
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession I7HXF9 I7HXF9
Species 38018 (Bacteriophage sp.) 38018 (Bacteriophage sp.)
Function annotation BioLiP:3pqhB BioLiP:3pqhB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3pqh-a3-m2-cB_3pqh-a3-m3-cB.pdb.gz
Full biological assembly
Download: 3pqh-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3pqh/1/1:A/2:A 3pqh/1/1:A/3:A 3pqh/1/2:A/3:A 3pqh/2/1:B/2:B 3pqh/2/1:B/3:B 3pqh/2/2:B/3:B 3pqh/3/1:A/2:A 3pqh/3/1:A/3:A 3pqh/3/1:B/2:B 3pqh/3/1:B/3:B 3pqh/3/2:A/3:A 3pqi/1/1:A/2:A 3pqi/1/1:A/3:A 3pqi/1/2:A/3:A
Other dimers with similar sequences but different poses
  • 3pqh/3/3:A/3:B 3pqh/3/1:A/1:B 3pqh/3/2:A/2:B
  • [Back to Home]