3pqk/3/1:F/1:E

Sequences

>3pqk-a3-m1-cF (length=99) [Search sequence]

REDMEKRANEVANLLKTLSHPVRLLVCTLVEGEFSVGELEQQIGIGQPTLSQQLGVLRES GIVETRRNIKQIFYRLTEAKAAQLVNALYTIFCAQEKQA

>3pqk-a3-m1-cE (length=100) [Search sequence]

TREDMEKRANEVANLLKTLSHPVRLLVCTLVEGEFSVGELEQQIGIGQPTLSQQLGVLRE SGIVETRRNIKQIFYRLTEAKAAQLVNALYTIFCAQEKQA

Structure information

PDB ID	3pqk (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the transcriptional repressor BigR from Xylella fastidiosa
Assembly ID	3
Resolution	2.09Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	78
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	E
UniProt accession	Q9PFB1	Q9PFB1
Species	2371 (Xylella fastidiosa)	2371 (Xylella fastidiosa)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3pqk-a3-m1-cF_3pqk-a3-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3pqk-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3pqj/1/1:B/1:A 3pqj/2/1:D/1:C 3pqk/1/1:A/1:B 3pqk/2/1:C/1:D