3pqk/3/1:F/1:E

Sequences
>3pqk-a3-m1-cF (length=99) [Search sequence]
REDMEKRANEVANLLKTLSHPVRLLVCTLVEGEFSVGELEQQIGIGQPTLSQQLGVLRES
GIVETRRNIKQIFYRLTEAKAAQLVNALYTIFCAQEKQA
>3pqk-a3-m1-cE (length=100) [Search sequence]
TREDMEKRANEVANLLKTLSHPVRLLVCTLVEGEFSVGELEQQIGIGQPTLSQQLGVLRE
SGIVETRRNIKQIFYRLTEAKAAQLVNALYTIFCAQEKQA
Structure information
PDB ID 3pqk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the transcriptional repressor BigR from Xylella fastidiosa
Assembly ID 3
Resolution 2.09Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 78
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession Q9PFB1 Q9PFB1
Species 2371 (Xylella fastidiosa) 2371 (Xylella fastidiosa)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3pqk-a3-m1-cF_3pqk-a3-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3pqk-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3pqj/1/1:B/1:A 3pqj/2/1:D/1:C 3pqk/1/1:A/1:B 3pqk/2/1:C/1:D

[Back to Home]