3q1d/1/1:A/2:A

Sequences
>3q1d-a1-m1-cA (length=47) [Search sequence]
QHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYK
>3q1d-a1-m2-cA (length=47) [Search sequence]
QHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYK
Structure information
PDB ID 3q1d (database links: RCSB PDB PDBe PDBj PDBsum)
Title The B-box domain of Trim54
Assembly ID 1
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q9BYV2 Q9BYV2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3q1dA BioLiP:3q1dA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3q1d-a1-m1-cA_3q1d-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3q1d-assembly1.cif.gz

[Back to Home]