3q7r/1/1:B/1:A

Sequences
>3q7r-a1-m1-cB (length=95) [Search sequence]
PKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYADLVVCEYSLLPREIRSPVLVLLDFF
DEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQ
>3q7r-a1-m1-cA (length=110) [Search sequence]
AGPKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPREIRSPK
SLEGSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQH
Structure information
PDB ID 3q7r (database links: RCSB PDB PDBe PDBj PDBsum)
Title 1.6A resolution structure of the ChxR receiver domain from Chlamydia trachomatis
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession A0A0H3MDW1 A0A0H3MDW1
Species 471472 (Chlamydia trachomatis 434/Bu) 471472 (Chlamydia trachomatis 434/Bu)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3q7r-a1-m1-cB_3q7r-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3q7r-assembly1.cif.gz
Similar dimers

[Back to Home]