3qdx/1/2:A/2:B

Sequences
>3qdx-a1-m2-cA (length=142) [Search sequence]
TYSITLRVFQRNPGRGFFSIVEKTVFHYANGGTWSEAKGTHTLTMGGSGTSGVLRFMSDK
GELITVAVGVHNYKRWCDVVTGLKPEETALVINPQYYNNGPRAYTREKQLAEYNVTSVVG
TRFEVKYTVVEGNNLEANVIFS
>3qdx-a1-m2-cB (length=142) [Search sequence]
TYSITLRVFQRNPGRGFFSIVEKTVFHYANGGTWSEAKGTHTLTMGGSGTSGVLRFMSDK
GELITVAVGVHNYKRWCDVVTGLKPEETALVINPQYYNNGPRAYTREKQLAEYNVTSVVG
TRFEVKYTVVEGNNLEANVIFS
Structure information
PDB ID 3qdx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the orthorhombic form of the Boletus edulis lectin in complex with T-antigen disaccharide and N,N-diacetyl chitobiose
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
PubMed citation 21303815
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession F2Z266 F2Z266
Species 36056 (Boletus edulis) 36056 (Boletus edulis)
Function annotation BioLiP:3qdxA BioLiP:3qdxB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3qdx-a1-m2-cA_3qdx-a1-m2-cB.pdb.gz
Full biological assembly
Download: 3qdx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3qds/1/1:A/1:B 3qds/1/2:A/2:B 3qdt/1/1:A/1:B 3qdt/1/2:A/2:B 3qdu/1/1:A/1:B 3qdu/1/1:C/1:D 3qdv/1/1:A/1:B 3qdv/1/2:A/2:B 3qdw/1/1:A/1:B 3qdw/1/2:A/2:B 3qdx/1/1:A/1:B 3qdy/1/1:A/1:B 3qdy/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 3qds/3/1:B/2:B 3qds/1/1:A/2:A 3qds/1/1:B/2:B 3qds/2/1:A/2:A 3qdt/1/1:A/2:A 3qdt/1/1:B/2:B 3qdt/2/1:A/2:A 3qdt/3/1:B/2:B 3qdu/1/1:A/1:D 3qdu/1/1:B/1:C 3qdu/2/1:A/1:D 3qdu/3/1:B/1:C 3qdv/1/1:A/2:A 3qdv/1/1:B/2:B 3qdv/2/1:A/2:A 3qdv/3/1:B/2:B 3qdw/1/1:A/2:A 3qdw/1/1:B/2:B 3qdw/2/1:A/2:A 3qdw/3/1:B/2:B 3qdx/1/1:A/2:A 3qdx/1/1:B/2:B 3qdx/2/1:A/2:A 3qdx/3/1:B/2:B 3qdy/1/1:A/2:A 3qdy/1/1:B/2:B 3qdy/2/1:A/2:A 3qdy/3/1:B/2:B
  • 3qds/1/1:A/2:B 3qds/1/1:B/2:A 3qdt/1/1:A/2:B 3qdt/1/1:B/2:A 3qdu/1/1:A/1:C 3qdu/1/1:B/1:D 3qdv/1/1:A/2:B 3qdv/1/1:B/2:A 3qdw/1/1:A/2:B 3qdw/1/1:B/2:A 3qdx/1/1:A/2:B 3qdx/1/1:B/2:A 3qdy/1/1:A/2:B 3qdy/1/1:B/2:A
  • [Back to Home]