3qfq/1/1:E/1:B

Sequences

>3qfq-a1-m1-cE (length=117) [Search sequence]

VPTDFPIDLSDYLSHAVYSNKTVSCFAIYTTSDKAIELYDKIEKFKVDFKSRHACELGCI LLFITLSKHRVSAIKNFCSTFCTISFLICKGVNKMPEMYNNLCKPPYKLLQENKPLL

>3qfq-a1-m1-cB (length=120) [Search sequence]

TPVPTDFPIDLSDYLSHAVYSNKTVSCFAIYTTSDKAIELYDKIEKFKVDFKSRHACELG CILLFITLSKHRVSAIKNFCSTFCTISFLICKGVNKMPEMYNNLCKPPYKLLQENKPLLN

Structure information

PDB ID	3qfq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Asymmetric Assembly of Merkel Cell Polyomavirus Large T-antigen Origin Binding Domains at the Viral Origin
Assembly ID	1
Resolution	2.9001Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0
PubMed citation	21501625

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	B
UniProt accession	E2IPT4	E2IPT4
Species	493803 (Merkel cell polyomavirus)	493803 (Merkel cell polyomavirus)
Function annotation	BioLiP:3qfqE	BioLiP:3qfqB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3qfq-a1-m1-cE_3qfq-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3qfq-assembly1.cif.gz