3qkb/1/1:B/1:A

Sequences
>3qkb-a1-m1-cB (length=90) [Search sequence]
QGFITTEGINAGYTIKDVVEATSSLLASEDIDKYNFDQLFDEAKQKLKKKADLLEGDGII
GLKYNTEVVEVNGAPKFLVVHGYGTVILID
>3qkb-a1-m1-cA (length=91) [Search sequence]
FQGFITTEGINAGYTIKDVVEATSSLLASEDIDKYNFDQLFDEAKQKLKKKADLLEGDGI
IGLKYNTEVVEVNGAPKFLVVHGYGTVILID
Structure information
PDB ID 3qkb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a Protein with unknown function which belongs to Pfam DUF74 family (PEPE_0654) from Pediococcus pentosaceus ATCC 25745 at 2.73 A resolution
Assembly ID 1
Resolution 2.73Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 69
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q03GF5 Q03GF5
Species 278197 (Pediococcus pentosaceus ATCC 25745) 278197 (Pediococcus pentosaceus ATCC 25745)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3qkb-a1-m1-cB_3qkb-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3qkb-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3qkb/1/1:C/1:B 3qkb/1/1:C/1:D 3qkb/1/1:E/1:A 3qkb/1/1:E/1:D

[Back to Home]