3qoq/1/1:C/1:A

Sequences
>3qoq-a1-m1-cC (length=47) [Search sequence]
TYSSRTADKFVVRLPEGREQIAEVARSHHRSNSEIIARLEQSLLQEG
>3qoq-a1-m1-cA (length=48) [Search sequence]
TYSSRTADKFVVRLPEGREQIAEVARSHHRSNSEIIARLEQSLLQEGA
Structure information
PDB ID 3qoq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Transcription Factor AmrZ in Complex with the 18 Base Pair amrZ1 Binding Site
Assembly ID 1
Resolution 3.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
PubMed citation 22511872
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession G3XCY4 G3XCY4
Species 287 (Pseudomonas aeruginosa) 287 (Pseudomonas aeruginosa)
Function annotation BioLiP:3qoqC BioLiP:3qoqA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3qoq-a1-m1-cC_3qoq-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3qoq-assembly1.cif.gz

[Back to Home]