3qpb/2/1:K/1:I

Sequences

>3qpb-a2-m1-cK (length=249) [Search sequence]

VGLQYHLQIRPGDVGRYVIMPGDPKRCAKIAEHFDNAVLVADSREYVTYTGTLNGEKVSV
TSTGIGGPSASIAMEELKLCGADTFIRVGTCGGIELDVKGGDIVIATGAIRMEGTSKEYA
PIEFPAVADLEVTNALVNAAKKLGYTSHAGVVQCKDAFYGQHEPERMPVSYELLNKWEAW
KRLGTKASEMESAALFVAASHLGVRCGSDFLVVGNQERNALGMDNPMAHDTEAAIQVAVE
ALRTLIEND

>3qpb-a2-m1-cI (length=250) [Search sequence]

Structure information

PDB ID	3qpb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Streptococcus Pyogenes Uridine Phosphorylase Reveals a Subclass of the NP-I Superfamily
Assembly ID	2
Resolution	1.82Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0
PubMed citation	21707079

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	K	I
UniProt accession	Q5XA29	Q5XA29
Species	301450 (Streptococcus pyogenes serotype M6)	301450 (Streptococcus pyogenes serotype M6)
Function annotation	BioLiP:3qpbK	BioLiP:3qpbI

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3qpb-a2-m1-cK_3qpb-a2-m1-cI.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3qpb-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3qpb/1/1:A/1:F 3qpb/1/1:B/1:C 3qpb/1/1:D/1:A 3qpb/1/1:D/1:F 3qpb/1/1:E/1:B 3qpb/1/1:E/1:C 3qpb/2/1:G/1:L 3qpb/2/1:H/1:I 3qpb/2/1:J/1:G 3qpb/2/1:J/1:L 3qpb/2/1:K/1:H 3qpb/3/1:N/1:O 3qpb/3/1:P/1:M 3qpb/3/1:Q/1:N 3qpb/3/1:Q/1:O 3qpb/3/1:R/1:M 3qpb/3/1:R/1:P
Other dimers with similar sequences but different poses	3qpb/3/1:P/1:O 3qpb/1/1:A/1:B 3qpb/1/1:D/1:C 3qpb/1/1:E/1:F 3qpb/2/1:G/1:H 3qpb/2/1:J/1:I 3qpb/2/1:K/1:L 3qpb/3/1:M/1:N 3qpb/3/1:R/1:Q 3qpb/3/1:M/1:O 3qpb/1/1:A/1:C 3qpb/1/1:B/1:F 3qpb/1/1:D/1:E 3qpb/2/1:G/1:I 3qpb/2/1:J/1:K 3qpb/2/1:L/1:H 3qpb/3/1:P/1:Q 3qpb/3/1:R/1:N