3qqt/2/4:A/7:B

Sequences
>3qqt-a2-m4-cA (length=70) [Search sequence]
AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQ
ALLCQKAIGT
>3qqt-a2-m7-cB (length=70) [Search sequence]
AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQ
ALLCQKAIGT
Structure information
PDB ID 3qqt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Amphiphilic nanotubes in the crystal structure of a biosurfactant protein hydrophobin HFBII
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
PubMed citation 21808803
Chain information
Chain 1 Chain 2
Model ID 4 7
Chain ID A B
UniProt accession P79073 P79073
Species 51453 (Trichoderma reesei) 51453 (Trichoderma reesei)
Function annotation BioLiP:3qqtA BioLiP:3qqtB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3qqt-a2-m4-cA_3qqt-a2-m7-cB.pdb.gz
Full biological assembly
Download: 3qqt-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3qqt/1/1:A/6:B 3qqt/1/1:A/7:B 3qqt/1/2:A/5:B 3qqt/1/2:A/8:B 3qqt/1/3:A/5:B 3qqt/1/3:A/8:B 3qqt/1/4:A/6:B 3qqt/1/4:A/7:B 3qqt/2/1:A/6:B 3qqt/2/1:A/7:B 3qqt/2/1:B/6:A 3qqt/2/1:B/7:A 3qqt/2/4:A/6:B 3qqt/2/4:B/6:A 3qqt/2/4:B/7:A
Other dimers with similar sequences but different poses
  • 3qqt/1/4:A/8:B 3qqt/1/1:A/5:B 3qqt/1/2:A/6:B 3qqt/1/3:A/7:B
  • 3qqt/1/7:B/8:B 3qqt/1/5:B/6:B
  • 3qqt/2/7:A/7:B 3qqt/2/1:A/1:B 3qqt/2/4:A/4:B 3qqt/2/6:A/6:B
  • 3qqt/2/4:B/7:B 3qqt/2/1:A/7:A 3qqt/2/1:B/6:B 3qqt/2/4:A/6:A
  • [Back to Home]