3qr7/2/4:B/5:B

Sequences

>3qr7-a2-m4-cB (length=114) [Search sequence]

ADALHIRFPDGAVIEYEPETSALTVGIKTASVTASGSVTATVPVVMVKASTRVTLDTPEV VCTNRLITGTLEVQKGGTMRGNIEHTGGELSSNGKVLHTHKHPGDSGGTTGSPL

>3qr7-a2-m5-cB (length=114) [Search sequence]

ADALHIRFPDGAVIEYEPETSALTVGIKTASVTASGSVTATVPVVMVKASTRVTLDTPEV VCTNRLITGTLEVQKGGTMRGNIEHTGGELSSNGKVLHTHKHPGDSGGTTGSPL

Structure information

PDB ID	3qr7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the C-terminal fragment of the bacteriophage P2 membrane-piercing protein gpV
Assembly ID	2
Resolution	0.94Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	325
Sequence identity between the two chains	1.0
PubMed citation	22325780

Chain information

	Chain 1	Chain 2
Model ID	4	5
Chain ID	B	B
UniProt accession	P31340	P31340
Species	10679 (Peduovirus P2)	10679 (Peduovirus P2)
Function annotation	BioLiP:3qr7B	BioLiP:3qr7B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3qr7-a2-m4-cB_3qr7-a2-m5-cB.pdb.gz

Full biological assembly Download: 3qr7-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3aqj/1/1:A/1:C 3aqj/1/1:B/1:A 3aqj/1/1:B/1:C 3aqj/2/1:P/1:Q 3aqj/2/1:P/1:R 3aqj/2/1:Q/1:R 3qr7/1/1:A/2:A 3qr7/1/1:A/3:A 3qr7/1/2:A/3:A 3qr7/2/1:B/4:B 3qr7/2/1:B/5:B