3qrf/2/1:H/1:I

Sequences
>3qrf-a2-m1-cH (length=82) [Search sequence]
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR
>3qrf-a2-m1-cI (length=82) [Search sequence]
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF
VRVESEKGAVWTVDELEFRKKR
Structure information
PDB ID 3qrf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a domain-swapped FOXP3 dimer
Assembly ID 2
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 137
Sequence identity between the two chains 1.0
PubMed citation 21458306
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H I
UniProt accession Q9BZS1 Q9BZS1
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3qrfH BioLiP:3qrfI
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3qrf-a2-m1-cH_3qrf-a2-m1-cI.pdb.gz
Full biological assembly
Download: 3qrf-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3qrf/1/1:F/1:G 4wk8/1/1:F/1:G

[Back to Home]