3qu2/6/1:C/1:D

Sequences

>3qu2-a6-m1-cC (length=221) [Search sequence]

KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQREL
GKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLER
LEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKA
GIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML

>3qu2-a6-m1-cD (length=221) [Search sequence]

Structure information

PDB ID	3qu2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Assembly ID	6
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0
PubMed citation	21894910

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q8A5V9	Q8A5V9
Species	818 (Bacteroides thetaiotaomicron)	818 (Bacteroides thetaiotaomicron)
Function annotation	BioLiP:3qu2C	BioLiP:3qu2D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3qu2-a6-m1-cC_3qu2-a6-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3qu2-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3qu2/2/1:A/1:B 3qu2/3/1:C/1:D 3qu2/4/1:C/1:D 3qu2/5/1:A/1:B 3qu2/5/1:C/1:D 3qu2/6/1:A/1:B 3qxg/1/1:A/1:B 3qxg/1/2:A/2:B
Other dimers with similar sequences but different poses	3qu2/6/1:B/1:C 3qu2/1/1:A/1:D 3qu2/2/1:A/1:D 3qu2/3/1:B/1:C 3qu2/4/1:B/1:C 3qu2/5/1:A/1:D 3qu2/5/1:B/1:C 3qu2/6/1:A/1:D 3qu7/3/1:A/2:B 3qxg/1/1:A/2:B 3qxg/1/2:A/1:B 3qxg/2/1:A/2:B