3qva/1/1:D/1:B

Sequences

>3qva-a1-m1-cD (length=103) [Search sequence]

STLSTHILDISTGTPAEGVTVSLSREGETLANLVTNAQGRIATFSAAPLPAGRYCLTAET GAWFARAGRESVFTRAQIDFVIGDHFHLPFLIAPGGWSTYRGS

>3qva-a1-m1-cB (length=105) [Search sequence]

HMSTLSTHILDISTGTPAEGVTVSLSREGETLANLVTNAQGRIATFSAAPLPAGRYCLTA ETGAWFARAGRESVFTRAQIDFVIGEDHFHLPFLIAPGGWSTYRG

Structure information

PDB ID	3qva (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Klebsiella pneumoniae 5-hydroxyisourate hydrolase
Assembly ID	1
Resolution	1.755Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	0.99

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	A6T926	A6T926
Species	272620 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578)	272620 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3qva-a1-m1-cD_3qva-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3qva-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3qva/1/1:D/1:A 3qva/1/1:B/1:C