3qy2/4/1:B/2:B

Sequences
>3qy2-a4-m1-cB (length=105) [Search sequence]
AFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTL
RILTEDEWRGLGITQSLGWEHYECHAAEPHILLFKRPLNYEAELR
>3qy2-a4-m2-cB (length=105) [Search sequence]
AFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTL
RILTEDEWRGLGITQSLGWEHYECHAAEPHILLFKRPLNYEAELR
Structure information
PDB ID 3qy2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the P93A monomer mutant of S. cerevisiae Cks1
Assembly ID 4
Resolution 2.59Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P20486 P20486
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3qy2-a4-m1-cB_3qy2-a4-m2-cB.pdb.gz
Full biological assembly
Download: 3qy2-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1qb3/5/1:B/3:B 1qb3/3/1:B/3:B 1qb3/3/4:B/5:B 1qb3/4/1:C/1:A
  • 4lpa/5/1:B/2:D 4lpa/5/1:A/2:C
  • 4lpa/5/1:A/2:D 4lpa/5/1:B/2:C
  • [Back to Home]