3r1z/1/1:A/1:B

Sequences

>3r1z-a1-m1-cA (length=354) [Search sequence]

VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTL
QGQYIIREIFAPVILGSDLSDYKQTLELAFKKVFNSAAKAIDLAYHDLLAKEQDISVAKL
LGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFS
KNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAAEITKFSNIPVVAD
ESVFDAKDAERVIDEQACNINIKLAKTGGILEAQKIKKLADSAGISCVGCESPAGILATA
SFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF

>3r1z-a1-m1-cB (length=356) [Search sequence]

Structure information

PDB ID	3r1z (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Complex with L-Ala-L-Glu and L-Ala-D-Glu
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	54
Sequence identity between the two chains	1.0
PubMed citation	22392983

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	B0TZW0	B0TZW0
Species	484022 (Francisella philomiragia subsp. philomiragia ATCC 25017)	484022 (Francisella philomiragia subsp. philomiragia ATCC 25017)
Function annotation	BioLiP:3r1zA	BioLiP:3r1zB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3r1z-a1-m1-cA_3r1z-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3r1z-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3r0k/1/1:A/1:B 3r0u/1/1:A/1:B 3r10/1/1:A/1:B 3r11/1/1:A/1:B