3r3t/1/2:B/1:A

Sequences

>3r3t-a1-m2-cB (length=91) [Search sequence]

RKYEIYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYIL NVNANAEAINEFDRLAKINEDILRHIVVKEE

>3r3t-a1-m1-cA (length=92) [Search sequence]

ARKYEIYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFYI LNVNANAEAINEFDRLAKINEDILRHIVVKEE

Structure information

PDB ID	3r3t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of 30S Ribosomal Protein S from Bacillus anthracis
Assembly ID	1
Resolution	2.302Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	302
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	B	A
UniProt accession	Q81JI2	Q81JI2
Species	260799 (Bacillus anthracis str. Sterne)	260799 (Bacillus anthracis str. Sterne)
Function annotation	BioLiP:3r3tB	BioLiP:3r3tA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3r3t-a1-m2-cB_3r3t-a1-m1-cA.pdb.gz

Full biological assembly Download: 3r3t-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3r3t/1/1:B/2:B 3r3t/1/1:A/2:A