3r7c/3/1:A/1:C

Sequences
>3r7c-a3-m1-cA (length=111) [Search sequence]
DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRI
DRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC
>3r7c-a3-m1-cC (length=111) [Search sequence]
DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRI
DRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC
Structure information
PDB ID 3r7c (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel Cd(2)Cl(4)O(6) cluster that aids in crystal packing
Assembly ID 3
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession Q63042 Q63042
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:3r7cA BioLiP:3r7cC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3r7c-a3-m1-cA_3r7c-a3-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3r7c-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1oqc/1/1:A/1:C 1oqc/2/1:B/1:D 3r7c/1/1:A/1:C 3r7c/2/1:B/1:D 3r7c/3/1:B/1:D
Other dimers with similar sequences but different poses
  • 3r7c/3/1:A/1:B 3r7c/2/1:A/1:B
  • [Back to Home]