3r8y/2/1:F/1:D

Sequences

>3r8y-a2-m1-cF (length=202) [Search sequence]

EKKTPVKVYIKGDLKEVTFPETVQAFVNKKSGVLFGEWSEIKTILDENSKYIVDYVVEND
RRNSAIPMLDLKGIKARIEPGAIIRDHVEIGDNAVIMMNATINIGAVIGEGSMIDMNAVL
GGRATVGKNCHVGAGAVLAGVIEPPSAKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGA
VVTEDVPPYTVVAGTPARVIKE

>3r8y-a2-m1-cD (length=203) [Search sequence]

Structure information

PDB ID	3r8y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Bacillus anthracis tetrahydropicolinate succinyltransferase
Assembly ID	2
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	113
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	D
UniProt accession	Q81MQ2	Q81MQ2
Species	1392 (Bacillus anthracis)	1392 (Bacillus anthracis)
Function annotation	BioLiP:3r8yF	BioLiP:3r8yD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3r8y-a2-m1-cF_3r8y-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3r8y-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3r8y/1/1:A/1:B 3r8y/1/1:C/1:A 3r8y/1/1:C/1:B 3r8y/2/1:D/1:E 3r8y/2/1:F/1:E