3rbg/3/1:D/3:D

Sequences
>3rbg-a3-m1-cD (length=103) [Search sequence]
SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHS
ANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATMKG
>3rbg-a3-m3-cD (length=103) [Search sequence]
SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHS
ANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATMKG
Structure information
PDB ID 3rbg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure analysis of Class-I MHC restricted T-cell associated molecule
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID D D
UniProt accession O95727 O95727
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3rbg-a3-m1-cD_3rbg-a3-m3-cD.pdb.gz
Full biological assembly
Download: 3rbg-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3rbg/1/1:A/1:C 3rbg/2/1:B/2:B

[Back to Home]