3rco/2/12:B/9:B

Sequences
>3rco-a2-m12-cB (length=78) [Search sequence]
GMLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAV
VRIETSRSGEITCYAMAC
>3rco-a2-m9-cB (length=78) [Search sequence]
GMLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAV
VRIETSRSGEITCYAMAC
Structure information
PDB ID 3rco (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a conserved motif in human TDRD7
Assembly ID 2
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 12 9
Chain ID B B
UniProt accession Q8NHU6 Q8NHU6
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3rco-a2-m12-cB_3rco-a2-m9-cB.pdb.gz
Full biological assembly
Download: 3rco-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3rco/1/10:B/11:B 3rco/1/12:B/9:B 3rco/1/1:B/4:B 3rco/1/2:B/3:B 3rco/1/5:B/8:B 3rco/1/6:B/7:B 3rco/2/10:B/11:B 3rco/2/1:B/4:B 3rco/2/2:B/3:B 3rco/2/5:B/8:B 3rco/2/6:B/7:B
Other dimers with similar sequences but different poses
  • 3rco/4/5:B/9:B 3rco/1/10:B/3:B 3rco/1/10:B/8:B 3rco/1/11:B/4:B 3rco/1/11:B/6:B 3rco/1/12:B/2:B 3rco/1/12:B/7:B 3rco/1/13:A/17:A 3rco/1/13:A/21:A 3rco/1/14:A/19:A 3rco/1/14:A/24:A 3rco/1/15:A/20:A 3rco/1/15:A/22:A 3rco/1/16:A/18:A 3rco/1/16:A/23:A 3rco/1/17:A/21:A 3rco/1/18:A/23:A 3rco/1/19:A/24:A 3rco/1/1:B/5:B 3rco/1/1:B/9:B 3rco/1/20:A/22:A 3rco/1/2:B/7:B 3rco/1/3:B/8:B 3rco/1/4:B/6:B 3rco/1/5:B/9:B 3rco/2/10:B/3:B 3rco/2/10:B/8:B 3rco/2/11:B/4:B 3rco/2/11:B/6:B 3rco/2/12:B/2:B 3rco/2/12:B/7:B 3rco/2/1:B/5:B 3rco/2/1:B/9:B 3rco/2/2:B/7:B 3rco/2/3:B/8:B 3rco/2/4:B/6:B 3rco/2/5:B/9:B 3rco/3/1:A/5:A 3rco/3/1:A/9:A 3rco/3/5:A/9:A 3rco/4/1:B/5:B 3rco/4/1:B/9:B
  • 3rco/1/16:A/9:B 3rco/1/13:A/11:B 3rco/1/14:A/10:B 3rco/1/15:A/12:B 3rco/1/17:A/3:B 3rco/1/18:A/2:B 3rco/1/19:A/4:B 3rco/1/20:A/1:B 3rco/1/21:A/7:B 3rco/1/22:A/6:B 3rco/1/23:A/8:B 3rco/1/24:A/5:B
  • [Back to Home]