3rkl/1/1:D/2:D

Sequences
>3rkl-a1-m1-cD (length=79) [Search sequence]
SKITINIKDNTIEYGHKEFVLSNLQEDIKNLAEIVYQLAKLIEKLSQYEEEVDTELYNLL
HEYAIYLAGATSFIDSENK
>3rkl-a1-m2-cD (length=79) [Search sequence]
SKITINIKDNTIEYGHKEFVLSNLQEDIKNLAEIVYQLAKLIEKLSQYEEEVDTELYNLL
HEYAIYLAGATSFIDSENK
Structure information
PDB ID 3rkl (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of A81 from Sulfolobus Turreted Icosahedral Virus
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 127
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID D D
UniProt accession Q6Q0J6 Q6Q0J6
Species 269145 (Sulfolobus turreted icosahedral virus 1) 269145 (Sulfolobus turreted icosahedral virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3rkl-a1-m1-cD_3rkl-a1-m2-cD.pdb.gz
Full biological assembly
Download: 3rkl-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3rkl/1/1:A/2:A 3rkl/1/1:B/1:C 3rkl/1/2:B/2:C
Other dimers with similar sequences but different poses
  • 3rkl/1/2:B/2:D 3rkl/1/1:A/1:C 3rkl/1/1:B/1:D 3rkl/1/2:A/2:C
  • [Back to Home]