3rl8/1/1:B/1:C

Sequences
>3rl8-a1-m1-cB (length=90) [Search sequence]
KIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVN
NVCLEEVTHEEAVTALKNTSDFVYLKVAKP
>3rl8-a1-m1-cC (length=95) [Search sequence]
KIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVN
NVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYM
Structure information
PDB ID 3rl8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of hDLG1-PDZ2 complexed with APC
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 21858148
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q12959 Q12959
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3rl8B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3rl8-a1-m1-cB_3rl8-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3rl8-assembly1.cif.gz

[Back to Home]