3rpn/3/1:C/1:F

Sequences

>3rpn-a3-m1-cC (length=220) [Search sequence]

GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPR
KGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASREL
WMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAF
GLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA

>3rpn-a3-m1-cF (length=220) [Search sequence]

Structure information

PDB ID	3rpn (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human kappa class glutathione transferase in complex with S-hexylglutathione
Assembly ID	3
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	69
Sequence identity between the two chains	1.0
PubMed citation	21728995

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	F
UniProt accession	Q9Y2Q3	Q9Y2Q3
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3rpnC	BioLiP:3rpnF

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3rpn-a3-m1-cC_3rpn-a3-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3rpn-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1yzx/1/1:A/1:B 3rpn/1/1:A/1:D 3rpn/2/1:B/1:E 3rpp/1/1:A/2:A 3rpp/2/1:C/1:B