3rv5/5/1:B/4:C

Sequences

>3rv5-a5-m1-cB (length=73) [Search sequence]

YKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVRLGQNPTPEELQEIDEVDED GSGTVDFDEFLVV

>3rv5-a5-m4-cC (length=77) [Search sequence]

DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVRLGQNPTPEELQEIDEVD EDGSGTVDFDEFLVVRC

Structure information

PDB ID	3rv5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium and deoxycholic acid
Assembly ID	5
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	21920370

Chain information

	Chain 1	Chain 2
Model ID	1	4
Chain ID	B	C
UniProt accession	P63316	P63316
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3rv5B	BioLiP:3rv5C

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3rv5-a5-m1-cB_3rv5-a5-m4-cC.pdb.gz

Full biological assembly Download: 3rv5-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3rv5/5/2:B/4:D 3rv5/5/1:A/3:C 3rv5/5/1:B/3:D 3rv5/5/2:A/4:C 3rv5/5/4:D/4:C 3rv5/5/1:B/1:A 3rv5/5/2:B/2:A 3rv5/5/3:D/3:C