3rv5/5/4:D/4:C

Sequences
>3rv5-a5-m4-cD (length=73) [Search sequence]
YKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVRLGQNPTPEELQEIDEVDED
GSGTVDFDEFLVV
>3rv5-a5-m4-cC (length=77) [Search sequence]
DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVRLGQNPTPEELQEIDEVD
EDGSGTVDFDEFLVVRC
Structure information
PDB ID 3rv5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium and deoxycholic acid
Assembly ID 5
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
PubMed citation 21920370
Chain information
Chain 1 Chain 2
Model ID 4 4
Chain ID D C
UniProt accession P63316 P63316
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3rv5D BioLiP:3rv5C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3rv5-a5-m4-cD_3rv5-a5-m4-cC.pdb.gz
Full biological assembly
Download: 3rv5-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3rv5/5/1:B/1:A 3rv5/5/2:B/2:A 3rv5/5/3:D/3:C
Other dimers with similar sequences but different poses
  • 3rv5/5/2:B/4:D 3rv5/5/1:A/3:C 3rv5/5/1:B/3:D 3rv5/5/2:A/4:C
  • 3rv5/5/1:B/4:C 3rv5/5/2:B/3:C
  • [Back to Home]