3ry0/1/2:B/3:B

Sequences

>3ry0-a1-m2-cB (length=63) [Search sequence]

PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAER RAS

>3ry0-a1-m3-cB (length=63) [Search sequence]

PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAER RAS

Structure information

PDB ID	3ry0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of TomN, a 4-Oxalocrotonate Tautomerase homologue in Tomaymycin biosynthetic pathway
Assembly ID	1
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	B	B
UniProt accession	C0LTT5	C0LTT5
Species	67255 (Streptomyces achromogenes)	67255 (Streptomyces achromogenes)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3ry0-a1-m2-cB_3ry0-a1-m3-cB.pdb.gz

Full biological assembly Download: 3ry0-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3ry0/1/1:A/2:A 3ry0/1/1:A/3:A 3ry0/1/1:B/2:B 3ry0/1/1:B/3:B 3ry0/1/2:A/3:A
Other dimers with similar sequences but different poses	3ry0/1/3:B/3:A 3ry0/1/1:B/1:A 3ry0/1/2:B/2:A