3ry0/1/3:B/3:A

Sequences
>3ry0-a1-m3-cB (length=63) [Search sequence]
PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAER
RAS
>3ry0-a1-m3-cA (length=65) [Search sequence]
PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAER
RASPS
Structure information
PDB ID 3ry0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of TomN, a 4-Oxalocrotonate Tautomerase homologue in Tomaymycin biosynthetic pathway
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID B A
UniProt accession C0LTT5 C0LTT5
Species 67255 (Streptomyces achromogenes) 67255 (Streptomyces achromogenes)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ry0-a1-m3-cB_3ry0-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3ry0-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ry0/1/1:B/1:A 3ry0/1/2:B/2:A
Other dimers with similar sequences but different poses
  • 3ry0/1/2:B/3:B 3ry0/1/1:A/2:A 3ry0/1/1:A/3:A 3ry0/1/1:B/2:B 3ry0/1/1:B/3:B 3ry0/1/2:A/3:A
  • [Back to Home]