3s6p/1/54:H/9:G

Sequences
>3s6p-a1-m54-cH (length=63) [Search sequence]
FAAAVSAFAANMLSSVLKSEATSSIIKSVGETAVGPGLLMSVPGKIAARVRARRARRRAA
RAN
>3s6p-a1-m9-cG (length=72) [Search sequence]
FAAAVSAFAANMLSSVLKSEATSSIIKSVGETAVGAAQSGLAKLPGLLMSVPGKIAARVR
ARRARRRAARAN
Structure information
PDB ID 3s6p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Helicoverpa Armigera Stunt Virus
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 54 9
Chain ID H G
UniProt accession Q82462 Q82462
Species 37206 (Helicoverpa armigera stunt virus) 37206 (Helicoverpa armigera stunt virus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3s6p-a1-m54-cH_3s6p-a1-m9-cG.pdb.gz
Full biological assembly
Download: 3s6p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3s6p/1/11:H/38:G 3s6p/1/12:H/47:G 3s6p/1/13:H/45:G 3s6p/1/14:H/29:G 3s6p/1/15:H/16:G 3s6p/1/16:H/28:G 3s6p/1/17:H/52:G 3s6p/1/18:H/60:G 3s6p/1/19:H/39:G 3s6p/1/1:H/23:G 3s6p/1/21:H/43:G 3s6p/1/24:H/54:G 3s6p/1/25:H/26:G 3s6p/1/26:H/53:G 3s6p/1/29:H/44:G 3s6p/1/2:H/42:G 3s6p/1/31:H/58:G 3s6p/1/32:H/7:G 3s6p/1/33:H/5:G 3s6p/1/34:H/49:G 3s6p/1/35:H/36:G 3s6p/1/36:H/48:G 3s6p/1/39:H/59:G 3s6p/1/3:H/50:G 3s6p/1/45:H/46:G 3s6p/1/55:H/56:G 3s6p/1/56:H/8:G 3s6p/1/5:H/6:G
Other dimers with similar sequences but different poses
  • 3s6p/1/8:H/9:G 3s6p/1/10:H/6:G 3s6p/1/11:H/12:G 3s6p/1/12:H/13:G 3s6p/1/13:H/14:G 3s6p/1/14:H/15:G 3s6p/1/16:H/17:G 3s6p/1/17:H/18:G 3s6p/1/18:H/19:G 3s6p/1/19:H/20:G 3s6p/1/1:H/2:G 3s6p/1/21:H/22:G 3s6p/1/22:H/23:G 3s6p/1/23:H/24:G 3s6p/1/24:H/25:G 3s6p/1/26:H/27:G 3s6p/1/27:H/28:G 3s6p/1/28:H/29:G 3s6p/1/29:H/30:G 3s6p/1/2:H/3:G 3s6p/1/31:H/32:G 3s6p/1/32:H/33:G 3s6p/1/33:H/34:G 3s6p/1/34:H/35:G 3s6p/1/36:H/37:G 3s6p/1/37:H/38:G 3s6p/1/38:H/39:G 3s6p/1/39:H/40:G 3s6p/1/3:H/4:G 3s6p/1/41:H/42:G 3s6p/1/42:H/43:G 3s6p/1/43:H/44:G 3s6p/1/44:H/45:G 3s6p/1/46:H/47:G 3s6p/1/47:H/48:G 3s6p/1/48:H/49:G 3s6p/1/49:H/50:G 3s6p/1/4:H/5:G 3s6p/1/51:H/52:G 3s6p/1/52:H/53:G 3s6p/1/53:H/54:G 3s6p/1/54:H/55:G 3s6p/1/56:H/57:G 3s6p/1/57:H/58:G 3s6p/1/58:H/59:G 3s6p/1/59:H/60:G 3s6p/1/6:H/7:G 3s6p/1/7:H/8:G
  • [Back to Home]