3s6p/1/9:H/24:G

Sequences
>3s6p-a1-m9-cH (length=63) [Search sequence]
FAAAVSAFAANMLSSVLKSEATSSIIKSVGETAVGPGLLMSVPGKIAARVRARRARRRAA
RAN
>3s6p-a1-m24-cG (length=72) [Search sequence]
FAAAVSAFAANMLSSVLKSEATSSIIKSVGETAVGAAQSGLAKLPGLLMSVPGKIAARVR
ARRARRRAARAN
Structure information
PDB ID 3s6p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Helicoverpa Armigera Stunt Virus
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 9 24
Chain ID H G
UniProt accession Q82462 Q82462
Species 37206 (Helicoverpa armigera stunt virus) 37206 (Helicoverpa armigera stunt virus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3s6p-a1-m9-cH_3s6p-a1-m24-cG.pdb.gz
Full biological assembly
Download: 3s6p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3s6p/1/10:H/1:G 3s6p/1/20:H/11:G 3s6p/1/22:H/2:G 3s6p/1/23:H/10:G 3s6p/1/27:H/17:G 3s6p/1/28:H/15:G 3s6p/1/30:H/21:G 3s6p/1/37:H/12:G 3s6p/1/38:H/20:G 3s6p/1/40:H/31:G 3s6p/1/41:H/3:G 3s6p/1/42:H/22:G 3s6p/1/43:H/30:G 3s6p/1/44:H/14:G 3s6p/1/46:H/13:G 3s6p/1/47:H/37:G 3s6p/1/48:H/35:G 3s6p/1/49:H/4:G 3s6p/1/4:H/34:G 3s6p/1/50:H/41:G 3s6p/1/51:H/18:G 3s6p/1/52:H/27:G 3s6p/1/53:H/25:G 3s6p/1/57:H/32:G 3s6p/1/58:H/40:G 3s6p/1/59:H/19:G 3s6p/1/60:H/51:G 3s6p/1/6:H/33:G 3s6p/1/7:H/57:G 3s6p/1/8:H/55:G
Other dimers with similar sequences but different poses
  • 3s6p/1/9:H/10:G 3s6p/1/15:H/11:G 3s6p/1/20:H/16:G 3s6p/1/25:H/21:G 3s6p/1/30:H/26:G 3s6p/1/35:H/31:G 3s6p/1/40:H/36:G 3s6p/1/45:H/41:G 3s6p/1/50:H/46:G 3s6p/1/55:H/51:G 3s6p/1/5:H/1:G 3s6p/1/60:H/56:G
  • [Back to Home]