3sb3/1/2:A/4:A

Sequences
>3sb3-a1-m2-cA (length=100) [Search sequence]
DAVVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAKSEISLKNSCLVAQSAAGQSFRLDTV
DEELTADTLKPGASVEGDAIFASEDDAVYGASLVRLSDRC
>3sb3-a1-m4-cA (length=100) [Search sequence]
DAVVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAKSEISLKNSCLVAQSAAGQSFRLDTV
DEELTADTLKPGASVEGDAIFASEDDAVYGASLVRLSDRC
Structure information
PDB ID 3sb3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an apag protein (PA1934) from pseudomonas aeruginosa pao1 at 1.83 A resolution
Assembly ID 1
Resolution 1.83Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession Q9I2H0 Q9I2H0
Species 287 (Pseudomonas aeruginosa) 287 (Pseudomonas aeruginosa)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3sb3-a1-m2-cA_3sb3-a1-m4-cA.pdb.gz
Full biological assembly
Download: 3sb3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3nrf/1/1:A/1:B 3nrf/1/1:A/2:B 3nrf/1/2:A/1:B 3nrf/1/2:A/2:B 3sb3/1/1:A/3:A 3sb3/1/1:A/4:A 3sb3/1/2:A/3:A

[Back to Home]