3sg8/3/1:A/1:B

Sequences

>3sg8-a3-m1-cA (length=298) [Search sequence]

MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNE
VNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAA
KDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDI
LENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEY
GMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSA

>3sg8-a3-m1-cB (length=298) [Search sequence]

Structure information

PDB ID	3sg8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Aminoglycoside-2''-Phosphotransferase Type IVa Tobramycin Complex
Assembly ID	3
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	62
Sequence identity between the two chains	1.0
PubMed citation	21678960

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O68183	O68183
Species	37734 (Enterococcus casseliflavus)	37734 (Enterococcus casseliflavus)
Function annotation	BioLiP:3sg8A	BioLiP:3sg8B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3sg8-a3-m1-cA_3sg8-a3-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3sg8-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3sg9/3/1:A/1:B 4dt8/3/1:B/1:A 4dt9/3/1:A/1:B 4dta/3/1:A/1:B 4dtb/3/1:A/1:B