3sh1/2/1:F/1:G

Sequences

>3sh1-a2-m1-cF (length=214) [Search sequence]

KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVYLSFSLLDIVKADSSTNEVDLV
YWEQQSWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVNSSG
HVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYGGWEIDLKTDTDQVDLSSYYASSK
YEILSATQTRSERFYECCKEPYPDVNLVVKFRER

>3sh1-a2-m1-cG (length=214) [Search sequence]

Structure information

PDB ID	3sh1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Ac-AChBP ligand binding domain mutated to human alpha-7 nAChR
Assembly ID	2
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	77
Sequence identity between the two chains	1.0
PubMed citation	22009746

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	G
UniProt accession	Q8WSF8	Q8WSF8
Species	6500 (Aplysia californica)	6500 (Aplysia californica)
Function annotation	BioLiP:3sh1F	BioLiP:3sh1G

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3sh1-a2-m1-cF_3sh1-a2-m1-cG.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3sh1-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2xyt/2/1:G/1:H 3sh1/1/1:A/1:B 3sh1/1/1:A/1:E 3sh1/1/1:B/1:C 3sh1/1/1:D/1:C 3sh1/1/1:D/1:E 3sh1/2/1:F/1:J 3sh1/2/1:G/1:H 3sh1/2/1:I/1:H 3sh1/2/1:I/1:J 3sio/1/1:A/1:B 3sio/1/1:A/1:E 3sio/1/1:B/1:C 3sio/1/1:D/1:C 3sio/1/1:D/1:E 3sio/2/1:F/1:G 3sio/2/1:F/1:J 3sio/2/1:G/1:H 3sio/2/1:I/1:H 3sio/2/1:I/1:J