3sju/2/1:A/1:B

Sequences

>3sju-a2-m1-cA (length=255) [Search sequence]

QTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGHDVDGSSCDVTS
TDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVL
RAGGMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVC
PGYVETPMAERVREGYARHWGVTEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAAS
ITAQALNVCGGLGNY

>3sju-a2-m1-cB (length=255) [Search sequence]

Structure information

PDB ID	3sju (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Hedamycin Polyketide Ketoreductase bound to NADPH
Assembly ID	2
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	126
Sequence identity between the two chains	1.0
PubMed citation	21776967

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q67G28	Q67G28
Species	1943 (Streptomyces griseoruber)	1943 (Streptomyces griseoruber)
Function annotation	BioLiP:3sjuA	BioLiP:3sjuB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3sju-a2-m1-cA_3sju-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3sju-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3sju/1/1:A/1:B 3sju/1/2:A/2:B
Other dimers with similar sequences but different poses	3sju/1/1:B/2:B 3sju/1/1:A/2:A 3sju/3/1:A/2:B 3sju/1/1:A/2:B 3sju/1/1:B/2:A