3soo/2/1:C/1:B

Sequences
>3soo-a2-m1-cC (length=74) [Search sequence]
VLDEGAVLTLAADLSSATLDISQWSNVFNILRENDFEPFLCEVLAFCDGEITFSDLQSLR
FASQSSELLDVLPQ
>3soo-a2-m1-cB (length=75) [Search sequence]
GVLDEGAVLTLAADLSSATLDISQWSNVFNILRENDFEPFLCEVLAFCDGEITFSDLQSL
RFASQSSELLDVLPQ
Structure information
PDB ID 3soo (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a LINE-1 type transposase domain-containing protein 1 (L1TD1) from HOMO SAPIENS at 2.73 A resolution
Assembly ID 2
Resolution 2.73Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 142
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession Q5T7N2 Q5T7N2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3soo-a2-m1-cC_3soo-a2-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3soo-assembly2.cif.gz
Similar dimers

[Back to Home]