3soo/2/1:C/1:B

Sequences

>3soo-a2-m1-cC (length=74) [Search sequence]

VLDEGAVLTLAADLSSATLDISQWSNVFNILRENDFEPFLCEVLAFCDGEITFSDLQSLR FASQSSELLDVLPQ

>3soo-a2-m1-cB (length=75) [Search sequence]

GVLDEGAVLTLAADLSSATLDISQWSNVFNILRENDFEPFLCEVLAFCDGEITFSDLQSL RFASQSSELLDVLPQ

Structure information

PDB ID	3soo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a LINE-1 type transposase domain-containing protein 1 (L1TD1) from HOMO SAPIENS at 2.73 A resolution
Assembly ID	2
Resolution	2.73Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	142
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q5T7N2	Q5T7N2
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3soo-a2-m1-cC_3soo-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3soo-assembly2.cif.gz

Similar dimers