3swy/1/1:A/1:C

Sequences
>3swy-a1-m1-cA (length=46) [Search sequence]
GALEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV
>3swy-a1-m1-cC (length=46) [Search sequence]
GALEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV
Structure information
PDB ID 3swy (database links: RCSB PDB PDBe PDBj PDBsum)
Title CNGA3 626-672 containing CLZ domain
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession Q16281 Q16281
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3swy-a1-m1-cA_3swy-a1-m1-cC.pdb.gz
Full biological assembly
Download: 3swy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3swy/1/1:A/1:B 3swy/1/1:B/1:C

[Back to Home]