3t0x/1/1:B/1:A

Sequences

>3t0x-a1-m1-cB (length=108) [Search sequence]

PVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRPSGVPD RFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTV

>3t0x-a1-m1-cA (length=110) [Search sequence]

PVLTQSPSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYNDDRRPSGVPD RFSGSKSGTSASLAISGLRSEDEADYYCLSWDDSLNGWVFGGGTKVTVLD

Structure information

PDB ID	3t0x (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Fluorogen Activating Protein M8VLA4(S55P) in complex with dimethylindole red
Assembly ID	1
Resolution	1.96Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0
PubMed citation	22390683

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3t0xB	BioLiP:3t0xA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3t0x-a1-m1-cB_3t0x-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3t0x-assembly1.cif.gz