3t1e/1/2:E/2:F

Sequences
>3t1e-a1-m2-cE (length=37) [Search sequence]
DVVDRIYKQVALESPLALLNTESIIMNAITSLSYQIN
>3t1e-a1-m2-cF (length=37) [Search sequence]
DVVDRIYKQVALESPLALLNTESIIMNAITSLSYQIN
Structure information
PDB ID 3t1e (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of the Newcastle disease virus hemagglutinin-neuraminidase (HN) ectodomain reveals a 4-helix bundle stalk
Assembly ID 1
Resolution 3.301Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID E F
UniProt accession P12554 P12554
Species 11177 (Newcastle disease virus (STRAIN AUSTRALIA-VICTORIA/32)) 11177 (Newcastle disease virus (STRAIN AUSTRALIA-VICTORIA/32))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3t1e-a1-m2-cE_3t1e-a1-m2-cF.pdb.gz
Full biological assembly
Download: 3t1e-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3t1e/1/1:E/1:F 3t1e/1/1:E/2:F 3t1e/1/1:F/2:E

[Back to Home]