3t1e/1/2:E/2:F

Sequences

>3t1e-a1-m2-cE (length=37) [Search sequence]

DVVDRIYKQVALESPLALLNTESIIMNAITSLSYQIN

>3t1e-a1-m2-cF (length=37) [Search sequence]

DVVDRIYKQVALESPLALLNTESIIMNAITSLSYQIN

Structure information

PDB ID	3t1e (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of the Newcastle disease virus hemagglutinin-neuraminidase (HN) ectodomain reveals a 4-helix bundle stalk
Assembly ID	1
Resolution	3.301Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	E	F
UniProt accession	P12554	P12554
Species	11177 (Newcastle disease virus (STRAIN AUSTRALIA-VICTORIA/32))	11177 (Newcastle disease virus (STRAIN AUSTRALIA-VICTORIA/32))

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3t1e-a1-m2-cE_3t1e-a1-m2-cF.pdb.gz

Full biological assembly Download: 3t1e-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3t1e/1/1:E/1:F 3t1e/1/1:E/2:F 3t1e/1/1:F/2:E