3t3a/2/2:B/2:A

Sequences
>3t3a-a2-m2-cB (length=119) [Search sequence]
ECPQDWLSHRDKCFRVSQVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKNSFW
IGLRYTLMNWKWINGSTLNSDVLKITGDTENDSCAAISGDKVTFESCNSDNRWICQKEL
>3t3a-a2-m2-cA (length=122) [Search sequence]
ECPQDWLSHRDKCFRVSQVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSF
WIGLRYTLPDMNWKWINGSTLNSDVLKITGDTENDSCAAISGDKVTFESCNSDNRWICQK
EL
Structure information
PDB ID 3t3a (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of H107R mutant of extracellular domain of mouse receptor NKR-P1A
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation 22139156
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession P27811 P27811
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:3t3aB BioLiP:3t3aA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3t3a-a2-m2-cB_3t3a-a2-m2-cA.pdb.gz
Full biological assembly
Download: 3t3a-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3t3a/1/1:B/1:A 3t3a/2/1:B/1:A
Other dimers with similar sequences but different poses
  • 3m9z/1/1:A/2:A 3t3a/2/1:A/2:A 3t3a/2/1:B/2:B
  • [Back to Home]