3t3c/1/1:A/1:B

Sequences

>3t3c-a1-m1-cA (length=99) [Search sequence]

PQISLWQRPVVTARIGGQLIEVLLDTGADDTVIEDIDLPGKWSPKMIAGIGGFVKVRQYD QILIEFCGKKAIGSVLVGPTPANVIGRNIMSQIGCTLNF

>3t3c-a1-m1-cB (length=99) [Search sequence]

PQISLWQRPVVTARIGGQLIEVLLDTGADDTVIEDIDLPGKWSPKMIAGIGGFVKVRQYD QILIEFCGKKAIGSVLVGPTPANVIGRNIMSQIGCTLNF

Structure information

PDB ID	3t3c (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of HIV PR resistant patient derived mutant (comprising 22 mutations) in complex with DRV
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	152
Sequence identity between the two chains	1.0
PubMed citation	22644035

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P03367	P03367
Species	11686 (Human immunodeficiency virus type 1 (BRU ISOLATE))	11686 (Human immunodeficiency virus type 1 (BRU ISOLATE))
Function annotation	BioLiP:3t3cA	BioLiP:3t3cB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3t3c-a1-m1-cA_3t3c-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3t3c-assembly1.cif.gz