3t3w/1/1:C/1:E

Sequences

>3t3w-a1-m1-cC (length=246) [Search sequence]

EMYIDYDVSDRIATITLNRPEAANAQNPELLDELDAAWTRAAEDNDVSVIVLRANGKHFS
AGHDLRGPDKLTLEFIYAHESRRYLEYSLRWRNVPKPSIAAVQGRCISGGLLLCWPCDLI
IAAEDALFSDPVVLMDIGGVEYHGHTWELGPRKAKEILFTGRAMTAEEVAQTGMVNRVVP
RDRLDAETRALAGEIAKMPPFALRQAKRAVNQTLDVQGFYAAIQSVFDIHQTGHGNAMSV
SGWPVL

>3t3w-a1-m1-cE (length=246) [Search sequence]

Structure information

PDB ID	3t3w (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of probable enoyl-COA hydratase from mycobacterium thermoresistibile
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	43
Sequence identity between the two chains	1.0
PubMed citation	25613812

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	E
UniProt accession	G3XAQ0	G3XAQ0
Species	1078020 (Mycolicibacterium thermoresistibile ATCC 19527)	1078020 (Mycolicibacterium thermoresistibile ATCC 19527)
Function annotation	BioLiP:3t3wC	BioLiP:3t3wE

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3t3w-a1-m1-cC_3t3w-a1-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3t3w-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3t3w/1/1:A/1:D 3t3w/1/1:B/1:F
Other dimers with similar sequences but different poses	3t3w/1/1:E/1:F 3t3w/1/1:A/1:E 3t3w/1/1:A/1:F 3t3w/1/1:B/1:C 3t3w/1/1:B/1:D 3t3w/1/1:C/1:D 3t3w/1/1:C/1:F 3t3w/1/1:B/1:A 3t3w/1/1:E/1:D