3t50/3/1:B/1:A

Sequences
>3t50-a3-m1-cB (length=108) [Search sequence]
TLMPMLITNPHLPDNPIVFANPAFLKLTGYEADEVMGRNCRFLQGHGTDPAHVRAIKSAI
AAEKPIDIDIINYKKSGEAFWNRLHISPVHNANGRLQHFVSSQLDVTL
>3t50-a3-m1-cA (length=115) [Search sequence]
ASEFTLMPMLITNPHLPDNPIVFANPAFLKLTGYEADEVMGRNCRFLQGHGTDPAHVRAI
KSAIAAEKPIDIDIINYKKSGEAFWNRLHISPVHNANGRLQHFVSSQLDVTLELV
Structure information
PDB ID 3t50 (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of the LOV domain from the LOV-HK sensory protein from Brucella abortus (dark state).
Assembly ID 3
Resolution 1.64Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
PubMed citation 22504229
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q8YC53 Q8YC53
Species 29459 (Brucella melitensis) 29459 (Brucella melitensis)
Function annotation BioLiP:3t50B BioLiP:3t50A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3t50-a3-m1-cB_3t50-a3-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3t50-assembly3.cif.gz

[Back to Home]