3t6o/2/1:A/1:B

Sequences
>3t6o-a2-m1-cA (length=115) [Search sequence]
AADIRVTHEAQVTVISFPAVFQRLRETEVEQIASTFLAAQGAQPRKVLIDLEGVEFFGSS
FIELLVRGWKRIKEDQQGVFALCSVSPYCVEVLQVTHIDEVWPRYSTKQEALLAA
>3t6o-a2-m1-cB (length=115) [Search sequence]
ADIRVTHEAQVTVISFPAVFQRLRETEVEQIASTFLAAQGAQPRKVLIDLEGVEFFGSSF
IELLVRGWKRIKEDQQGVFALCSVSPYCVEVLQVTHIDEVWPRYSTKQEALLAAS
Structure information
PDB ID 3t6o (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Structure of an Anti-sigma-factor antagonist (STAS) domain protein from Planctomyces limnophilus.
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 0.991
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession D5SP81 D5SP81
Species 521674 (Planctopirus limnophila DSM 3776) 521674 (Planctopirus limnophila DSM 3776)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3t6o-a2-m1-cA_3t6o-a2-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3t6o-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3t6o/1/1:A/1:B 3t6o/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 3t6o/2/1:A/1:C 3t6o/1/1:A/1:C 3t6o/1/2:A/2:C
  • 3t6o/2/1:B/1:C 3t6o/1/1:B/1:C 3t6o/1/2:B/2:C
  • [Back to Home]