3t6o/2/1:B/1:C

Sequences
>3t6o-a2-m1-cB (length=115) [Search sequence]
ADIRVTHEAQVTVISFPAVFQRLRETEVEQIASTFLAAQGAQPRKVLIDLEGVEFFGSSF
IELLVRGWKRIKEDQQGVFALCSVSPYCVEVLQVTHIDEVWPRYSTKQEALLAAS
>3t6o-a2-m1-cC (length=115) [Search sequence]
ADIRVTHEAQVTVISFPAVFQRLRETEVEQIASTFLAAQGAQPRKVLIDLEGVEFFGSSF
IELLVRGWKRIKEDQQGVFALCSVSPYCVEVLQVTHIDEVWPRYSTKQEALLAAS
Structure information
PDB ID 3t6o (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Structure of an Anti-sigma-factor antagonist (STAS) domain protein from Planctomyces limnophilus.
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession D5SP81 D5SP81
Species 521674 (Planctopirus limnophila DSM 3776) 521674 (Planctopirus limnophila DSM 3776)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3t6o-a2-m1-cB_3t6o-a2-m1-cC.pdb.gz
Full biological assembly
Download: 3t6o-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3t6o/1/1:B/1:C 3t6o/1/2:B/2:C
Other dimers with similar sequences but different poses
  • 3t6o/2/1:A/1:B 3t6o/1/1:A/1:B 3t6o/1/2:A/2:B
  • 3t6o/2/1:A/1:C 3t6o/1/1:A/1:C 3t6o/1/2:A/2:C
  • [Back to Home]